Recombinant Human OXCT1

• Cat.No.: OXCT1-30531TH
• Product Overview: Recombinant fragment of Human OXCT1 with a N terminal proprietary tag: predicted molecular weight 31.57 kDa.

Specification

• Description: This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.
• Molecular Weight: 31.570kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLS
• Sequence Similarities: Belongs to the 3-oxoacid CoA-transferase family.
• Tag: Non

Gene Information

• Gene Name: OXCT1 3-oxoacid CoA transferase 1 [ Homo sapiens ]
• Official Symbol: OXCT1
• Synonyms: OXCT1; 3-oxoacid CoA transferase 1; 3 oxoacid CoA transferase , OXCT; succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT
• Gene ID: 5019
• mRNA Refseq: NM_000436
• Protein Refseq: NP_000427
• MIM: 601424
• Uniprot ID: P55809
• Chromosome Location: 5p13
• Pathway: Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem
• Function: 3-oxoacid CoA-transferase activity; 3-oxoacid CoA-transferase activity; protein homodimerization activity; transferase activity