Recombinant Human OVGP1

• Cat.No.: OVGP1-30528TH
• Product Overview: Recombinant fragment of Human OVGP1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions.
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Oviduct.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
• Sequence Similarities: Belongs to the glycosyl hydrolase 18 family.

Gene Information

• Gene Name: OVGP1 oviductal glycoprotein 1, 120kDa [ Homo sapiens ]
• Official Symbol: OVGP1
• Synonyms: OVGP1; oviductal glycoprotein 1, 120kDa; MUC9, mucin 9; oviduct-specific glycoprotein; CHIT5; oviductin
• Gene ID: 5016
• mRNA Refseq: NM_002557
• Protein Refseq: NP_002548
• MIM: 603578
• Uniprot ID: Q12889
• Chromosome Location: 1p13.2
• Function: catalytic activity; cation binding; chitinase activity