Recombinant Human OTX1

Cat.No. : OTX1-30526TH
Product Overview : Recombinant fragment corresponding to amino acids 10-116 of Human Otx1 with an N terminal proprietary tag; Predicted MWt 37.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 107 amino acids
Description : This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mouse is required for proper brain and sensory organ development and can cause epilepsy. Alternate splicing results in two transcript variants that encoded the same protein.
Molecular Weight : 37.400kDa inclusive of tags
Tissue specificity : Expressed in brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQ LDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNR RAKCRQQQQSGSGTKSRPAKKKSSPVR
Sequence Similarities : Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name OTX1 orthodenticle homeobox 1 [ Homo sapiens ]
Official Symbol OTX1
Synonyms OTX1; orthodenticle homeobox 1; orthodenticle (Drosophila) homolog 1 , orthodenticle homolog 1 (Drosophila); homeobox protein OTX1;
Gene ID 5013
mRNA Refseq NM_001199770
Protein Refseq NP_001186699
MIM 600036
Uniprot ID P32242
Chromosome Location 2p15
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All OTX1 Products

Required fields are marked with *

My Review for All OTX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon