Recombinant Human OSTF1, His-tagged
Cat.No. : | OSTF1-28124TH |
Product Overview : | Recombinant full length Human OSTF1 with C terminal His tag; 222 amino acids with a predicted MWt 25.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 214 amino acids |
Description : | Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al. |
Conjugation : | HIS |
Molecular Weight : | 25.100kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. Present in osteoclasts (at protein level). |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 0.01% DTT, 10% Glycerol |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELYFEEGD IIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPL HEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGG HKDIVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQ LFLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDA VRTLSNAEDYLDDEDSDLEHHHHHH |
Sequence Similarities : | Contains 3 ANK repeats.Contains 1 SH3 domain. |
Gene Name | OSTF1 osteoclast stimulating factor 1 [ Homo sapiens ] |
Official Symbol | OSTF1 |
Synonyms | OSTF1; osteoclast stimulating factor 1; osteoclast-stimulating factor 1; bA235O14.1; OSF; SH3P2; |
Gene ID | 26578 |
mRNA Refseq | NM_012383 |
Protein Refseq | NP_036515 |
MIM | 610180 |
Uniprot ID | Q92882 |
Chromosome Location | 9q13-q21.2 |
Function | SH3 domain binding; |
◆ Native Proteins | ||
LDHA-26867TH | Native Human LDHA | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ovary-756B | Bovine Ovary Membrane Lysate, Total Protein | +Inquiry |
CACFD1-7926HCL | Recombinant Human C9orf7 293 Cell Lysate | +Inquiry |
ARHGEF25-5962HCL | Recombinant Human GEFT 293 Cell Lysate | +Inquiry |
ALDH16A1-56HCL | Recombinant Human ALDH16A1 cell lysate | +Inquiry |
GYPB-313HCL | Recombinant Human GYPB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OSTF1 Products
Required fields are marked with *
My Review for All OSTF1 Products
Required fields are marked with *
0
Inquiry Basket