Recombinant Human ORMDL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ORMDL3-6328H
• Product Overview: ORMDL3 MS Standard C13 and N15-labeled recombinant protein (NP_644809) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ORMDL3 (ORMDL Sphingolipid Biosynthesis Regulator 3) is a Protein Coding gene. Diseases associated with ORMDL3 include Asthma and Inflammatory Bowel Disease 22. Among its related pathways are Sphingolipid metabolism and Innate Immune System. An important paralog of this gene is ORMDL1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.5 kDa
• AA Sequence: MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ORMDL3 ORMDL sphingolipid biosynthesis regulator 3 [ Homo sapiens (human) ]
• Official Symbol: ORMDL3
• Synonyms: ORMDL3; ORM1-like 3 (S. cerevisiae); ORM1 (S. cerevisiae) like 3; ORM1-like protein 3
• Gene ID: 94103
• mRNA Refseq: NM_139280
• Protein Refseq: NP_644809
• MIM: 610075
• UniProt ID: Q8N138