Recombinant Human OLR1 protein(61-150 aa), C-His-tagged

• Cat.No.: OLR1-2808H
• Product Overview: Recombinant Human OLR1 protein(P78380)(61-150 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-150 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 12 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIW

Gene Information

• Gene Name: OLR1 oxidized low density lipoprotein (lectin-like) receptor 1 [ Homo sapiens ]
• Official Symbol: OLR1
• Synonyms: OLR1; oxidized low density lipoprotein (lectin-like) receptor 1; oxidised low density lipoprotein (lectin like) receptor 1; oxidized low-density lipoprotein receptor 1; CLEC8A; LOX 1; SCARE1; hLOX-1; ox LDL receptor 1; lectin-type oxidized LDL receptor 1; scavenger receptor class E, member 1; C-type lectin domain family 8 member A; oxidized low-density lipoprotein receptor 1, soluble form; LOX1; LOXIN; SLOX1
• Gene ID: 4973
• mRNA Refseq: NM_001172632
• Protein Refseq: NP_001166103
• MIM: 602601
• UniProt ID: P78380