Recombinant Human OLA1, His-tagged
Cat.No. : | OLA1-29179TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-238 of Human GTPBP9 with an N terminal His tag. Predicted mwt: 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-238 a.a. |
Description : | GTPBP9 belongs to the GTP1/OBG family. It hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. It has lower affinity for GTP.. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKK PVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDY IRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQEL SAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPD EVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYED FKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTP QQPKKK |
Full Length : | Full L. |
Gene Name | OLA1 Obg-like ATPase 1 [ Homo sapiens ] |
Official Symbol | OLA1 |
Synonyms | OLA1; Obg-like ATPase 1; GTP binding protein 9 (putative) , GTPBP9; obg-like ATPase 1; PTD004; |
Gene ID | 29789 |
mRNA Refseq | NM_001011708 |
Protein Refseq | NP_001011708 |
MIM | 611175 |
Uniprot ID | Q9NTK5 |
Chromosome Location | 2q31.1 |
Function | ATP binding; GTP binding; hydrolase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
BOTF-1599C | Recombinant Clostridium Botulinum BOTF Protein (1-436 aa), His-tagged | +Inquiry |
AHRR-4485C | Recombinant Chicken AHRR | +Inquiry |
SNRPB-068H | Recombinant Human SNRPB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNIK-31580TH | Recombinant Human TNIK | +Inquiry |
NI36-RS08060-0887S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS08060 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VLDL-395H | Native Human Very Low Density Lipoprotein, DiI labeled | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
IGHA1-18H | Native Human IgA1 | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM17-2479HCL | Recombinant Human RBM17 293 Cell Lysate | +Inquiry |
RNFT2-550HCL | Recombinant Human RNFT2 lysate | +Inquiry |
GPRC5C-748HCL | Recombinant Human GPRC5C cell lysate | +Inquiry |
UPK1A-723HCL | Recombinant Human UPK1A lysate | +Inquiry |
CNTN3-1562MCL | Recombinant Mouse CNTN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OLA1 Products
Required fields are marked with *
My Review for All OLA1 Products
Required fields are marked with *
0
Inquiry Basket