Recombinant Human OBP2A protein, His&Myc-tagged

• Cat.No.: OBP2A-3533H
• Product Overview: Recombinant Human OBP2A protein(Q9NY56)(16-170aa(C114S,K127N)), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 16-170aa(C114S,K127N)
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

Gene Information

• Gene Name: OBP2A odorant binding protein 2A [ Homo sapiens (human) ]
• Official Symbol: OBP2A
• Synonyms: OBP2A; OBP; OBP2C; OBPIIa; hOBPIIa; odorant binding protein 2A; odorant-binding protein 2a; odorant-binding protein Iia; putative odorant-binding protein 2c
• Gene ID: 29991
• mRNA Refseq: NM_014582
• Protein Refseq: NP_055397
• MIM: 164320
• UniProt ID: Q9NY56