Recombinant Human NXNL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NXNL1-3922H
Product Overview : NXNL1 MS Standard C13 and N15-labeled recombinant protein (NP_612463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP.
Molecular Mass : 23.9 kDa
AA Sequence : MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NXNL1 nucleoredoxin-like 1 [ Homo sapiens (human) ]
Official Symbol NXNL1
Synonyms NXNL1; nucleoredoxin-like 1; thioredoxin like 6, TXNL6; nucleoredoxin-like protein 1; RDCVF; thioredoxin-like 6; thioredoxin-like protein 6; rod-derived cone viability factor; TXNL6;
Gene ID 115861
mRNA Refseq NM_138454
Protein Refseq NP_612463
MIM 608791
UniProt ID Q96CM4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NXNL1 Products

Required fields are marked with *

My Review for All NXNL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon