Recombinant Human NUP37 protein, His-tagged
Cat.No. : | NUP37-3157H |
Product Overview : | Recombinant Human NUP37 protein(53-102 aa), fused to His tag, was expressed in E. coli. |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 53-102 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EEEADVEGIQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NUP37 nucleoporin 37kDa [ Homo sapiens ] |
Official Symbol | NUP37 |
Synonyms | NUP37; nucleoporin 37kDa; nucleoporin Nup37; FLJ22618; MGC5585; nup107-160 subcomplex subunit Nup37; p37; |
Gene ID | 79023 |
mRNA Refseq | NM_024057 |
Protein Refseq | NP_076962 |
MIM | 609264 |
UniProt ID | Q8NFH4 |
◆ Recombinant Proteins | ||
NUP37-2045HFL | Recombinant Full Length Human NUP37 Protein, C-Flag-tagged | +Inquiry |
NUP37-1564H | Recombinant Human NUP37 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUP37-2021H | Recombinant Human NUP37 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nup37-4553M | Recombinant Mouse Nup37 Protein, Myc/DDK-tagged | +Inquiry |
NUP37-732Z | Recombinant Zebrafish NUP37 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP37-3631HCL | Recombinant Human NUP37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUP37 Products
Required fields are marked with *
My Review for All NUP37 Products
Required fields are marked with *
0
Inquiry Basket