Recombinant Human NUCB2 protein

• Cat.No.: NUCB2-654H
• Product Overview: Recombinant Human NUCB2 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 82
• Description: Nesfatin is a metabolic polypeptide and is the N-terminal region of the precursor protein, Nucleobindin2 (encoded by NUCB2 gene). It is a naturally occurring protein and originally identified as a hypothalamic neuropeptide. Additionally, Nesfatin can be found in other areas of brain, and in pancreatic islets β-cells, gastric endocrine cells and adipocytes. It is responsible for regulating appetite and production of body fat. Excess nesfatin-1 in the brain leads to a loss of appetite, less frequent hunger, a "sense of fullness", and a drop in body fat and weight. A lack of nesfatin-1 in the brain leads to an increase of appetite, more frequent episodes of hunger, an increase of body fat and weight, and the inability to "feel full".
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The biological activity is tested by in vivo assay using healthy wild type male mice (C57BL/6J).
• Molecular Mass: Approximately 9.6 kDa, a single non-glycosylated polypeptide chain containing 82 amino acids.
• AA Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
• Endotoxin: Less than 1 EU/µg of rHuNesfatin-1 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: NUCB2
• Official Symbol: NUCB2
• Synonyms: NUCB2; nucleobindin 2; nucleobindin-2; NEFA; nucleobinding 2; DNA-binding protein NEFA; gastric cancer antigen Zg4
• Gene ID: 4925
• mRNA Refseq: NM_005013
• Protein Refseq: NP_005004
• MIM: 608020
• UniProt ID: P80303