Recombinant Human NRK protein, GST-tagged

• Cat.No.: NRK-15H
• Product Overview: Recombinant Human NRK(1483 a.a. - 1582 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1483-1582 a.a.
• Description: The mouse ortholog of this gene encodes a protein kinase required for JNK activation. The encoded protein may be involved in the induction of actin polymerization in late embryogenesis.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: NRK Nik related kinase [ Homo sapiens ]
• Official Symbol: NRK
• Synonyms: NRK; Nik related kinase; nik-related protein kinase; DKFZp686A17109; NESK; FLJ16788; MGC131849
• Gene ID: 203447
• mRNA Refseq: NM_198465
• Protein Refseq: NP_940867
• MIM: 300791
• UniProt ID: Q7Z2Y5
• Chromosome Location: Xq22.3
• Pathway: TNF receptor signaling pathway, organism-specific biosystem
• Function: ATP binding; nucleotide binding; protein serine/threonine kinase activity; small GTPase regulator activity