Recombinant Human NRF1

Description :	This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1.
Protein length :	85 amino acids
Molecular Weight :	34.980kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Ubiquitously expressed with strongest expression in skeletal muscle.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
Sequence Similarities :	Belongs to the NRF1/Ewg family.
Tag :	Non

Gene Name	NRF1 nuclear respiratory factor 1 [ Homo sapiens ]
Official Symbol	NRF1
Synonyms	NRF1; nuclear respiratory factor 1; alpha palindromic binding protein; ALPHA PAL; EWG;
Gene ID	4899
mRNA Refseq	NM_001040110
Protein Refseq	NP_001035199
MIM	600879
Uniprot ID	Q16656
Chromosome Location	7q32
Pathway	Energy Metabolism, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem;
Function	DNA binding;