Recombinant Human NRD1 protein, GST-tagged

• Cat.No.: NRD1-186H
• Product Overview: Recombinant Human NRD1(1058 a.a. - 1156 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1058-1156 a.a.
• Description: This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: VVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFDRLAHEIEALKSFS KSDLVNWFKAHRGPGSKMLSVHVV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: NRD1 nardilysin (N-arginine dibasic convertase) [ Homo sapiens ]
• Official Symbol: NRD1
• Synonyms: NRD1; nardilysin (N-arginine dibasic convertase); nardilysin; hNRD1; hNRD2; NRD-C; NRD convertase
• Gene ID: 4898
• mRNA Refseq: NM_002525
• Protein Refseq: NP_002516
• MIM: 602651
• UniProt ID: O43847
• Chromosome Location: 1p32.2-p32.1
• Function: epidermal growth factor binding; metal ion binding; metalloendopeptidase activity; peptidase activity; protein binding; zinc ion binding