Recombinant Human NR4A2 Protein, GST-tagged

• Cat.No.: NR4A2-1020H
• Product Overview: Recombinant Human full length NR4A2 (AAH09288.1, 1 a.a. - 598 a.a.) protein was expressed in wheat germ with GST tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-598 a.a.
• Description: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 93 kDa
• AA Sequence: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
• Storage: Store at -80 centigrade.
• Full Length: Full L.

Gene Information

• Gene Name: NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens ]
• Official Symbol: NR4A2
• Synonyms: NR4A2; nuclear receptor subfamily 4, group A, member 2; NURR1; nuclear receptor subfamily 4 group A member 2; HZF 3; NOT; RNR1; TINUR
• Gene ID: 4929
• mRNA Refseq: NM_006186
• Protein Refseq: NP_006177
• MIM: 601828
• UniProt ID: P43354