Recombinant Human NR4A2( 347S) Protein, His tagged

Description :	This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Source :	E. coli
Species :	Human
Tag :	His
AA Sequence :	MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPAKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Purity :	> 85% by SDS-PAGE
Storage :	Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration :	0.3 mg/mL
Storage Buffer :	PBS, pH 7.4

Gene Name	NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens (human) ]
Official Symbol	NR4A2
Synonyms	NR4A2; nuclear receptor subfamily 4, group A, member 2; NURR1; nuclear receptor subfamily 4 group A member 2; HZF 3; NOT; RNR1; TINUR; nuclear receptor related 1; T-cell nuclear receptor NOT; orphan nuclear receptor NR4A2; orphan nuclear receptor NURR1; intermediate-early receptor protein; immediate-early response protein NOT; nur related protein-1, human homolog of; transcriptionally-inducible nuclear receptor; NGFI-B/nur77 beta-type transcription factor homolog; transcriptionally inducible nuclear receptor related 1; HZF-3;
Gene ID	4929
mRNA Refseq	NM_006186
Protein Refseq	NP_006177
MIM	601828
UniProt ID	P43354

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry