Recombinant Human NPR3 Protein, GST-tagged

• Cat.No.: NPR3-6046H
• Product Overview: Human NPR3 partial ORF ( NP_000899, 42 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The family of natriuretic peptides (see MIM 108780) elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. These effects are mediated by specific binding of the peptides to cell surface receptors in the vasculature, kidney, adrenal, and brain.[supplied by OMIM
• Molecular Mass: 36.63 kDa
• AA Sequence: RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPR3 natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) [ Homo sapiens ]
• Official Symbol: NPR3
• Synonyms: NPR3; natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C); ANPRC, C5orf23, chromosome 5 open reading frame 23 , NPRC; atrial natriuretic peptide receptor 3; FLJ14054; GUCY2B; atrial natriuretic peptide receptor type C; atrial natriuretic peptide clearance receptor; NPRC; ANP-C; ANPRC; NPR-C; ANPR-C; C5orf23; MGC22189
• Gene ID: 4883
• mRNA Refseq: NM_000908
• Protein Refseq: NP_000899
• MIM: 108962
• UniProt ID: P17342