Recombinant Human NPPA

• Cat.No.: NPPA-27326TH
• Product Overview: Recombinant full length Human ANP with N terminal proprietary tag; Predicted MWt 42.57 kDa.

Specification

• Description: The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6.
• Protein length: 153 amino acids
• Molecular Weight: 42.570kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDF KNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEV PPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR
• Sequence Similarities: Belongs to the natriuretic peptide family.
• Tag: Non

Gene Information

• Gene Name: NPPA natriuretic peptide A [ Homo sapiens ]
• Official Symbol: NPPA
• Synonyms: NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A
• Gene ID: 4878
• mRNA Refseq: NM_006172
• Protein Refseq: NP_006163
• MIM: 108780
• Uniprot ID: P01160
• Chromosome Location: 1p36.21
• Pathway: Amyloids, organism-specific biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: hormone activity; peptide hormone receptor binding; receptor binding; receptor binding