Recombinant Human NPM1

Cat.No. : NPM1-27765TH
Product Overview : Recombinant full length Human Nucleophosmin with N terminal proprietary tag, 58.45kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 295 amino acids
Description : This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
Molecular Weight : 58.450kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEH QLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK MSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAA DEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTP AKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD QEAIQDLWQWRKSL
Sequence Similarities : Belongs to the nucleoplasmin family.
Gene Name NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
Official Symbol NPM1
Synonyms NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin;
Gene ID 4869
mRNA Refseq NM_001037738
Protein Refseq NP_001032827
MIM 164040
Uniprot ID P06748
Chromosome Location 5q35.1
Pathway Aurora B signaling, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem;
Function NF-kappaB binding; NF-kappaB binding; RNA binding; Tat protein binding; histone binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NPM1 Products

Required fields are marked with *

My Review for All NPM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon