Recombinant Human NPLOC4 Protein, GST-tagged

• Cat.No.: NPLOC4-6035H
• Product Overview: Human NPL4 partial ORF ( NP_060391, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NPLOC4 (NPL4 Homolog, Ubiquitin Recognition Factor) is a Protein Coding gene. Diseases associated with NPLOC4 include Dementia, Frontotemporal. Among its related pathways are Protein processing in endoplasmic reticulum and Translesion synthesis by Y family DNA polymerases bypasses lesions on DNA template. GO annotations related to this gene include ubiquitin protein ligase binding and ubiquitin binding.
• Molecular Mass: 37.73 kDa
• AA Sequence: MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPLOC4 nuclear protein localization 4 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: NPLOC4
• Synonyms: NPLOC4; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog; FLJ20657; KIAA1499; NPL4; FLJ23742
• Gene ID: 55666
• mRNA Refseq: NM_017921
• Protein Refseq: NP_060391
• MIM: 606590
• UniProt ID: Q8TAT6