Recombinant Human NPEPPS Protein, GST-tagged

• Cat.No.: NPEPPS-6023H
• Product Overview: Human NPEPPS partial ORF ( NP_006301.2, 776 a.a. - 875 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the puromycin-sensitive aminopeptidase, a zinc metallopeptidase which hydrolyzes amino acids from the N-terminus of its substrate. The protein has been localized to both the cytoplasm and to cellular membranes. This enzyme degrades enkaphalins in the brain, and studies in mouse suggest that it is involved in proteolytic events regulating the cell cycle. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: SKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPEPPS aminopeptidase puromycin sensitive [ Homo sapiens ]
• Official Symbol: NPEPPS
• Synonyms: NPEPPS; aminopeptidase puromycin sensitive; puromycin-sensitive aminopeptidase; metalloproteinase MP100; MP100; PSA; puromycin sensitive aminopeptidase; cytosol alanyl aminopeptidase; AAP-S
• Gene ID: 9520
• mRNA Refseq: NM_006310
• Protein Refseq: NP_006301
• MIM: 606793
• UniProt ID: P55786