Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NPDC1-935H
• Product Overview: NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: NPDC1 (Neural Proliferation, Differentiation And Control 1) is a Protein Coding gene.
• Molecular Mass: 34.5 kDa
• AA Sequence: MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NPDC1 neural proliferation, differentiation and control 1 [ Homo sapiens (human) ]
• Official Symbol: NPDC1
• Synonyms: NPDC1; neural proliferation, differentiation and control 1; CAB; CAB-; CAB1; CAB-1; NPDC-1; neural proliferation differentiation and control protein 1
• Gene ID: 56654
• mRNA Refseq: NM_015392
• Protein Refseq: NP_056207
• MIM: 605798
• UniProt ID: Q9NQX5