Recombinant Human NOV Protein, GST-tagged
Cat.No. : | NOV-6000H |
Product Overview : | Human NOV full-length ORF ( AAH15028, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq |
Molecular Mass : | 65.01 kDa |
AA Sequence : | MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDEGSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOV nephroblastoma overexpressed [ Homo sapiens ] |
Official Symbol | NOV |
Synonyms | NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP-9; IGFBP-9; |
Gene ID | 4856 |
mRNA Refseq | NM_002514 |
Protein Refseq | NP_002505 |
MIM | 164958 |
UniProt ID | P48745 |
◆ Recombinant Proteins | ||
NOV-4466H | Recombinant Human NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
NOV-2677H | Recombinant Human Nephroblastoma Overexpressed Gene | +Inquiry |
NOV-3688R | Recombinant Rat NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
NOV-180C | Recombinant Cynomolgus NOV, His-tagged | +Inquiry |
NOV-6144M | Recombinant Mouse NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOV-694HCL | Recombinant Human NOV cell lysate | +Inquiry |
NOV-001CCL | Recombinant Cynomolgus NOV cell lysate | +Inquiry |
NOV-897CCL | Recombinant Canine NOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOV Products
Required fields are marked with *
My Review for All NOV Products
Required fields are marked with *
0
Inquiry Basket