Recombinant Human NOS2 Protein, GST-tagged

• Cat.No.: NOS2-5992H
• Product Overview: Human NOS2A partial ORF ( NP_000616, 685 a.a. - 794 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ]
• Official Symbol: NOS2
• Synonyms: NOS2; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes) , NOS2A; nitric oxide synthase, inducible; HEP NOS; iNOS; NOS; NOS type II; NOS, type II; inducible NOS; hepatocyte NOS; inducible NO synthase; nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2; nitric oxide synthase 2A (inducible, hepatocytes); INOS; NOS2A; HEP-NOS
• Gene ID: 4843
• mRNA Refseq: NM_000625
• Protein Refseq: NP_000616
• MIM: 163730
• UniProt ID: P35228