Recombinant Human NOS2 protein(1-200aa), His-tagged

• Cat.No.: NOS2-5432H
• Product Overview: Recombinant Human NOS2 protein(P35228)(1-200aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-200aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC

Gene Information

• Gene Name: NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ]
• Official Symbol: NOS2
• Synonyms: NOS2; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes) , NOS2A; nitric oxide synthase, inducible; HEP NOS; iNOS; NOS; NOS type II; NOS, type II; inducible NOS; hepatocyte NOS; inducible NO synthase; nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2; nitric oxide synthase 2A (inducible, hepatocytes); INOS; NOS2A; HEP-NOS
• Gene ID: 4843
• mRNA Refseq: NM_000625
• Protein Refseq: NP_000616
• MIM: 163730
• UniProt ID: P35228