Recombinant Human NOP16 Protein, GST-tagged

Cat.No. : NOP16-5271H
Product Overview : Human HSPC111 full-length ORF ( AAH40106, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).
Molecular Mass : 45.32 kDa
AA Sequence : MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOP16 NOP16 nucleolar protein homolog (yeast) [ Homo sapiens ]
Official Symbol NOP16
Synonyms NOP16; NOP16 nucleolar protein homolog (yeast); nucleolar protein 16 homolog (yeast); nucleolar protein 16; HBV pre S2 trans regulated protein 3; HSPC111; HSPC185; hypothetical protein HSPC111; LOC51491; nucleolar protein 16 homolog; HBV pre-S2 trans-regulated protein 3;
Gene ID 51491
mRNA Refseq NM_001256539
Protein Refseq NP_001243468
MIM 612861
UniProt ID Q9Y3C1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NOP16 Products

Required fields are marked with *

My Review for All NOP16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon