Recombinant Human NOP16 Protein, GST-tagged
Cat.No. : | NOP16-5271H |
Product Overview : | Human HSPC111 full-length ORF ( AAH40106, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008). |
Molecular Mass : | 45.32 kDa |
AA Sequence : | MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOP16 NOP16 nucleolar protein homolog (yeast) [ Homo sapiens ] |
Official Symbol | NOP16 |
Synonyms | NOP16; NOP16 nucleolar protein homolog (yeast); nucleolar protein 16 homolog (yeast); nucleolar protein 16; HBV pre S2 trans regulated protein 3; HSPC111; HSPC185; hypothetical protein HSPC111; LOC51491; nucleolar protein 16 homolog; HBV pre-S2 trans-regulated protein 3; |
Gene ID | 51491 |
mRNA Refseq | NM_001256539 |
Protein Refseq | NP_001243468 |
MIM | 612861 |
UniProt ID | Q9Y3C1 |
◆ Recombinant Proteins | ||
NOP16-5651HF | Recombinant Full Length Human NOP16 Protein, GST-tagged | +Inquiry |
NOP16-3067R | Recombinant Rhesus monkey NOP16 Protein, His-tagged | +Inquiry |
NOP16-10782M | Recombinant Mouse NOP16 Protein | +Inquiry |
NOP16-6133M | Recombinant Mouse NOP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOP16-7099H | Recombinant Human NOP16, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOP16-3765HCL | Recombinant Human NOP16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOP16 Products
Required fields are marked with *
My Review for All NOP16 Products
Required fields are marked with *
0
Inquiry Basket