Recombinant Human NOP16 Protein, GST-tagged

• Cat.No.: NOP16-5271H
• Product Overview: Human HSPC111 full-length ORF ( AAH40106, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.32 kDa
• AA Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOP16 NOP16 nucleolar protein homolog (yeast) [ Homo sapiens ]
• Official Symbol: NOP16
• Synonyms: NOP16; NOP16 nucleolar protein homolog (yeast); nucleolar protein 16 homolog (yeast); nucleolar protein 16; HBV pre S2 trans regulated protein 3; HSPC111; HSPC185; hypothetical protein HSPC111; LOC51491; nucleolar protein 16 homolog; HBV pre-S2 trans-regulated protein 3
• Gene ID: 51491
• mRNA Refseq: NM_001256539
• Protein Refseq: NP_001243468
• MIM: 612861
• UniProt ID: Q9Y3C1