Recombinant Human NOG protein, His-tagged, Animal-Free

• Cat.No.: NOG-1993H
• Product Overview: Recombinant Human NOG protein(Q13253) with C-terminal His tag was expressed in E. coli and Animal-free.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: Lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4.
• Bio-activity: Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4.
• Molecular Mass: The protein has a calculated MW of 24 kDa. The protein migrates as 27 kDa under reducing condition (SDS-PAGE analysis).
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Gene Information

• Gene Name: NOG noggin [ Homo sapiens ]
• Official Symbol: NOG
• Synonyms: NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1
• Gene ID: 9241
• mRNA Refseq: NM_005450
• Protein Refseq: NP_005441
• MIM: 602991
• UniProt ID: Q13253