Recombinant Human NOG protein, His-tagged, Animal-Free
Cat.No. : | NOG-1993H |
Product Overview : | Recombinant Human NOG protein(Q13253) with C-terminal His tag was expressed in E. coli and Animal-free. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | Lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. |
Bio-activity : | Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4. |
Molecular Mass : | The protein has a calculated MW of 24 kDa. The protein migrates as 27 kDa under reducing condition (SDS-PAGE analysis). |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Gene Name | NOG noggin [ Homo sapiens ] |
Official Symbol | NOG |
Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
Gene ID | 9241 |
mRNA Refseq | NM_005450 |
Protein Refseq | NP_005441 |
MIM | 602991 |
UniProt ID | Q13253 |
◆ Recombinant Proteins | ||
NOG-5966H | Recombinant Human NOG Protein, GST-tagged | +Inquiry |
NOG-3117H | Recombinant Human NOG protein, For Organoid Culture | +Inquiry |
NOG-321H | Recombinant Human NOG Protein, His-tagged | +Inquiry |
Nog-10603M | Recombinant Mouse Nog Protein, His (Fc)-Avi-tagged | +Inquiry |
NOG-2849H | Recombinant Human NOG protein(28-232 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
0
Inquiry Basket