Recombinant Human NOG Protein, His-tagged
Cat.No. : | NOG-13H |
Product Overview : | Recombinant human Noggin (28-232 aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 211 |
Description : | The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. The results of the mouse knockout of the ortholog suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. Recently, several dominant human NOG mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) were identified; both SYM1 and SYNS1 have multiple joint fusion as their principal feature, and map to the same region (17q22) as this gene. All of these mutations altered evolutionarily conserved amino acid residues. The amino acid sequence of this human gene is highly homologous to that of Xenopus, rat and mouse. |
Form : | Liquid |
Molecular Mass : | 23.8 kDa |
AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | 50mM MES buffer (pH 6.5) containing 30% glycerol |
Gene Name | NOG noggin [ Homo sapiens (human) ] |
Official Symbol | NOG |
Synonyms | NOG; noggin; SYM1; SYNS1; SYNS1A; noggin; symphalangism 1 (proximal) |
Gene ID | 9241 |
mRNA Refseq | NM_005450 |
Protein Refseq | NP_005441 |
MIM | 602991 |
UniProt ID | Q13253 |
◆ Cell & Tissue Lysates | ||
NP-001SCL | Recombinant SARS NP cell lysate | +Inquiry |
NP-479HCL | Recombinant H2N2 NP cell lysate | +Inquiry |
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
NP-001HCL | Recombinant H1N1 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NP Products
Required fields are marked with *
My Review for All NP Products
Required fields are marked with *
0
Inquiry Basket