Recombinant Human NME6 Protein, GST-tagged
Cat.No. : | NME6-5934H |
Product Overview : | Human NME6 full-length ORF ( AAH01808, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the NM23 gene family (see MIM 156490).[supplied by OMIM |
Molecular Mass : | 47.08 kDa |
AA Sequence : | MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ] |
Official Symbol | NME6 |
Synonyms | NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA; |
Gene ID | 10201 |
mRNA Refseq | NM_005793 |
Protein Refseq | NP_005784 |
MIM | 608294 |
UniProt ID | O75414 |
◆ Recombinant Proteins | ||
Nme6-1457M | Recombinant Mouse Nme6 protein, His-tagged | +Inquiry |
NME6-749C | Recombinant Cynomolgus NME6 Protein, His-tagged | +Inquiry |
NME6-493C | Recombinant Cynomolgus Monkey NME6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NME6-3870H | Recombinant Human NME6 Protein (Leu11-Ala190), His tagged | +Inquiry |
NME6-207H | Recombinant Human NME6 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME6-3787HCL | Recombinant Human NME6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME6 Products
Required fields are marked with *
My Review for All NME6 Products
Required fields are marked with *
0
Inquiry Basket