Recombinant Human NME6 Protein, GST-tagged

• Cat.No.: NME6-5934H
• Product Overview: Human NME6 full-length ORF ( AAH01808, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the NM23 gene family (see MIM 156490).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.08 kDa
• AA Sequence: MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ]
• Official Symbol: NME6
• Synonyms: NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA
• Gene ID: 10201
• mRNA Refseq: NM_005793
• Protein Refseq: NP_005784
• MIM: 608294
• UniProt ID: O75414