Recombinant Human NME1 Protein, GST-tagged

• Cat.No.: NME1-5924H
• Product Overview: Human NME1 full-length ORF ( AAH00293, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by this gene) and B (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq
• Molecular Mass: 42.46 kDa
• AA Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NME1 non-metastatic cells 1, protein (NM23A) expressed in [ Homo sapiens ]
• Official Symbol: NME1
• Synonyms: NME1; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; NM23; NM23 H1; NDP kinase A; granzyme A-activated DNase; metastasis inhibition factor nm23; tumor metastatic process-associated protein; NB; AWD; NBS; GAAD; NDKA; NDPKA; NDPK-A; NM23-H1
• Gene ID: 4830
• mRNA Refseq: NM_000269
• Protein Refseq: NP_000260
• MIM: 156490
• UniProt ID: P15531