Recombinant Human NME1 Protein, GST-tagged
Cat.No. : | NME1-5924H |
Product Overview : | Human NME1 full-length ORF ( AAH00293, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by this gene) and B (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq |
Molecular Mass : | 42.46 kDa |
AA Sequence : | MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NME1 non-metastatic cells 1, protein (NM23A) expressed in [ Homo sapiens ] |
Official Symbol | NME1 |
Synonyms | NME1; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; NM23; NM23 H1; NDP kinase A; granzyme A-activated DNase; metastasis inhibition factor nm23; tumor metastatic process-associated protein; NB; AWD; NBS; GAAD; NDKA; NDPKA; NDPK-A; NM23-H1; |
Gene ID | 4830 |
mRNA Refseq | NM_000269 |
Protein Refseq | NP_000260 |
MIM | 156490 |
UniProt ID | P15531 |
◆ Recombinant Proteins | ||
NME1-3473H | Recombinant Human NME1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NME1-6108M | Recombinant Mouse NME1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NME1-4021H | Recombinant Human NME1 protein, His-tagged | +Inquiry |
NME1-3054R | Recombinant Rhesus monkey NME1 Protein, His-tagged | +Inquiry |
NME1-748H | Recombinant Human NME1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME1-3792HCL | Recombinant Human NME1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME1 Products
Required fields are marked with *
My Review for All NME1 Products
Required fields are marked with *
0
Inquiry Basket