Recombinant Human NME1 protein, GST-tagged

• Cat.No.: NME1-1310H
• Product Overview: Recombinant Human NME1 protein(1-152 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-152 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: NME1 non-metastatic cells 1, protein (NM23A) expressed in [ Homo sapiens ]
• Official Symbol: NME1
• Synonyms: NME1; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; NM23; NM23 H1; NDP kinase A; granzyme A-activated DNase; metastasis inhibition factor nm23; tumor metastatic process-associated protein; NB; AWD; NBS; GAAD; NDKA; NDPKA; NDPK-A; NM23-H1
• mRNA Refseq: NM_000269
• Protein Refseq: NP_000260
• MIM: 156490
• UniProt ID: P15531
• Gene ID: 4830