Recombinant Human NMB Protein, GST-tagged

• Cat.No.: NMB-5922H
• Product Overview: Human NMB full-length ORF ( AAH08603, 25 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR). Polymorphisms of this gene may be associated with hunger, weight gain and obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
• Molecular Mass: 36.41 kDa
• AA Sequence: APLSWDLPEPRSRASEIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTATHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NMB neuromedin B [ Homo sapiens ]
• Official Symbol: NMB
• Synonyms: NMB; neuromedin B; neuromedin-B; MGC2277; MGC3936; MGC17211
• Gene ID: 4828
• mRNA Refseq: NM_021077
• Protein Refseq: NP_066563
• MIM: 162340
• UniProt ID: P08949