Recombinant Human NKIRAS1 Protein, GST-tagged

• Cat.No.: NKIRAS1-5890H
• Product Overview: Human NKIRAS1 partial ORF ( AAH12145, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NKIRAS1 (NFKB Inhibitor Interacting Ras Like 1) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS2.
• Molecular Mass: 36.74 kDa
• AA Sequence: MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ]
• Official Symbol: NKIRAS1
• Synonyms: NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1
• Gene ID: 28512
• mRNA Refseq: NM_020345
• Protein Refseq: NP_065078
• MIM: 604496
• UniProt ID: Q9NYS0