Recombinant Human NISCH Protein, GST-tagged

Cat.No. : NISCH-5878H
Product Overview : Human NISCH partial ORF ( AAH56900, 1246 a.a. - 1345 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a nonadrenergic imidazoline-1 receptor protein that localizes to the cytosol and anchors to the inner layer of the plasma membrane. The orthologous mouse protein has been shown to influence cytoskeletal organization and cell migration by binding to alpha-5-beta-1 integrin. In humans, this protein has been shown to bind to the adapter insulin receptor substrate 4 (IRS4) to mediate translocation of alpha-5 integrin from the cell membrane to endosomes. Expression of this protein was reduced in human breast cancers while its overexpression reduced tumor growth and metastasis; possibly by limiting the expression of alpha-5 integrin. In human cardiac tissue, this gene was found to affect cell growth and death while in neural tissue it affected neuronal growth and differentiation. Alternative splicing results in multiple transcript variants encoding differerent isoforms. Some isoforms lack the expected C-terminal domains of a functional imidazoline receptor. [provided by RefSeq, Jan 2013]
Molecular Mass : 36.74 kDa
AA Sequence : LTGSTPMQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTFTVAQKMAEPEKAPAL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NISCH nischarin [ Homo sapiens ]
Official Symbol NISCH
Synonyms NISCH; nischarin; I 1; I 1 receptor candidate protein; imidazoline receptor antisera selected; imidazoline receptor candidate; IRAS; KIAA0975; IR1; hIRAS; I1R candidate protein; imidazoline receptor 1; I-1 receptor candidate protein; imidazoline-1 receptor candidate protein; imidazoline receptor antisera-selected protein; I-1; FLJ14425; FLJ40413; FLJ90519;
Gene ID 11188
mRNA Refseq NM_007184
Protein Refseq NP_009115
UniProt ID Q9Y2I1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NISCH Products

Required fields are marked with *

My Review for All NISCH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon