Recombinant Human NGFRAP1 Protein (1-111 aa), GST-tagged

Cat.No. : NGFRAP1-684H
Product Overview : Recombinant Human NGFRAP1 Protein (1-111 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-111 aa
Description : May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 40.0 kDa
AA Sequence : MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name NGFRAP1 nerve growth factor receptor (TNFRSF16) associated protein 1 [ Homo sapiens ]
Official Symbol NGFRAP1
Synonyms NGFRAP1; protein BEX3; Bex; BEX3; brain expressed; X linked 3; DXS6984E; HGR74; NADE;
Gene ID 27018
mRNA Refseq NM_014380
Protein Refseq NP_055195
MIM 300361
UniProt ID Q00994

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NGFRAP1 Products

Required fields are marked with *

My Review for All NGFRAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon