Recombinant Human NGFRAP1 Protein (1-111 aa), GST-tagged

• Cat.No.: NGFRAP1-684H
• Product Overview: Recombinant Human NGFRAP1 Protein (1-111 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Apoptosis. Protein Description: Full Length.

Specification

• Description: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 40.0 kDa
• Protein length: 1-111 aa
• AA Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NGFRAP1 nerve growth factor receptor (TNFRSF16) associated protein 1 [ Homo sapiens ]
• Official Symbol: NGFRAP1
• Synonyms: NGFRAP1; protein BEX3; Bex; BEX3; brain expressed; X linked 3; DXS6984E; HGR74; NADE
• Gene ID: 27018
• mRNA Refseq: NM_014380
• Protein Refseq: NP_055195
• MIM: 300361
• UniProt ID: Q00994