Recombinant Human NFKBIA, His-tagged

Cat.No. : NFKBIA-28232TH
Product Overview : Recombinant full length Human IKB alpha with N terminal His tag; 337 amino acids with tag, Predicted MWt 37.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 317 amino acids
Description : This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease.
Conjugation : HIS
Molecular Weight : 37.700kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMFQAAERPQEWAMEGPRDGL KKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQE VPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVK GDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCD PELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSIL KATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEP CNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPY QLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTE SEFTEFTEDELPYDDCVFGGQRLTL
Sequence Similarities : Belongs to the NF-kappa-B inhibitor family.Contains 5 ANK repeats.
Gene Name NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha [ Homo sapiens ]
Official Symbol NFKBIA
Synonyms NFKBIA; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha; NFKBI; NF-kappa-B inhibitor alpha; IkappaBalpha; IKBA; MAD 3;
Gene ID 4792
mRNA Refseq NM_020529
Protein Refseq NP_065390
MIM 164008
Uniprot ID P25963
Chromosome Location 14q13
Pathway Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem;
Function NF-kappaB binding; NF-kappaB binding; enzyme binding; heat shock protein binding; identical protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NFKBIA Products

Required fields are marked with *

My Review for All NFKBIA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon