Recombinant Human NFKB1 protein, His-tagged

• Cat.No.: NFKB1-563H
• Product Overview: Recombinant Human NFKB1 protein(P19838)(1-433aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-433a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.4 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

Gene Information

• Gene Name: NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ]
• Official Symbol: NFKB1
• Synonyms: NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NF kB1; NFkappaB; NFKB p50; p50; p105; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit; EBP-1; NF-kB1; NFKB-p50; NF-kappaB; NFKB-p105; NF-kappa-B; MGC54151; DKFZp686C01211
• Gene ID: 4790
• mRNA Refseq: NM_001165412
• Protein Refseq: NP_001158884
• MIM: 164011
• UniProt ID: P19838