Recombinant Human NDUFV1

• Cat.No.: NDUFV1-29479TH
• Product Overview: Recombinant fragment of Human NDUFV1 with N-terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The mitochondrial respiratory chain provides energy to cells via oxidative phosphorylation and consists of four membrane-bound electron-transporting protein complexes (I-IV) and an ATP synthase (complex V). This gene encodes a 51 kDa subunit of the NADH:ubiquinone oxidoreductase complex I; a large complex with at least 45 nuclear and mitochondrial encoded subunits that liberates electrons from NADH and channels them to ubiquinone. This subunit carries the NADH-binding site as well as flavin mononucleotide (FMN)- and Fe-S-biding sites. Defects in complex I are a common cause of mitochondrial dysfunction; a syndrome that occurs in approximately 1 in 10,000 live births. Mitochondrial complex I deficiency is linked to myopathies, encephalomyopathies, and neurodegenerative disorders such as Parkinsons disease and Leigh syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
• Sequence Similarities: Belongs to the complex I 51 kDa subunit family.

Gene Information

• Gene Name: NDUFV1 NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [ Homo sapiens ]
• Official Symbol: NDUFV1
• Synonyms: NDUFV1; NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa; NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD); NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; CI 51K; complex I 51kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot
• Gene ID: 4723
• mRNA Refseq: NM_001166102
• Protein Refseq: NP_001159574
• MIM: 161015
• Uniprot ID: P49821
• Chromosome Location: 11q13
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem
• Function: 4 iron, 4 sulfur cluster binding; FMN binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity