Recombinant Human NDUFAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NDUFAB1-713H
• Product Overview: NDUFAB1 MS Standard C13 and N15-labeled recombinant protein (NP_004994) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Carrier of the growing fatty acid chain in fatty acid biosynthesis. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
• Molecular Mass: 17.2 kDa
• AA Sequence: MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NDUFAB1 NADH:ubiquinone oxidoreductase subunit AB1 [ Homo sapiens (human) ]
• Official Symbol: NDUFAB1
• Synonyms: NDUFAB1; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP); acyl carrier protein, mitochondrial; ACP; acyl carrier protein; mitochondrial; complex I SDAP subunit; FASN2A; SDAP; CI-SDAP; mitochondrial acyl carrier protein; NADH:ubiquinone oxidoreductase SDAP subunit; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; MGC65095
• Gene ID: 4706
• mRNA Refseq: NM_005003
• Protein Refseq: NP_004994
• MIM: 603836
• UniProt ID: O14561