Recombinant Human NDUFA9

• Cat.No.: NDUFA9-28709TH
• Product Overview: Recombinant fragment of Human NDUFA9 with N terminal proprietary tag, predicted mwt: 33.88 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 75 amino acids
• Description: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12.
• Molecular Weight: 33.880kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
• Sequence Similarities: Belongs to the complex I NDUFA9 subunit family.

Gene Information

• Gene Name: NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ]
• Official Symbol: NDUFA9
• Synonyms: NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR
• Gene ID: 4704
• mRNA Refseq: NM_005002
• Protein Refseq: NP_004993
• MIM: 603834
• Uniprot ID: Q16795
• Chromosome Location: 12p13.3
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem
• Function: NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; NADH dehydrogenase activity; nucleotide binding