Recombinant Human NDUFA3 protein, GST-tagged

• Cat.No.: NDUFA3-3268H
• Product Overview: Recombinant Human NDUFA3 protein(O95167)(2-84aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 2-84aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.1 kDa
• AA Sequence: AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NDUFA3 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa [ Homo sapiens ]
• Official Symbol: NDUFA3
• Synonyms: NDUFA3; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3; B9; complex I B9 subunit; complex I-B9; NADH-ubiquinone oxidoreductase B9 subunit; CI-B9
• Gene ID: 4696
• mRNA Refseq: NM_004542
• Protein Refseq: NP_004533
• MIM: 603832
• UniProt ID: O95167