Recombinant Human NDUFA3 protein, GST-tagged

Cat.No. : NDUFA3-3268H
Product Overview : Recombinant Human NDUFA3 protein(O95167)(2-84aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-84aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.1 kDa
AA Sequence : AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NDUFA3 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa [ Homo sapiens ]
Official Symbol NDUFA3
Synonyms NDUFA3; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3; B9; complex I B9 subunit; complex I-B9; NADH-ubiquinone oxidoreductase B9 subunit; CI-B9;
Gene ID 4696
mRNA Refseq NM_004542
Protein Refseq NP_004533
MIM 603832
UniProt ID O95167

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NDUFA3 Products

Required fields are marked with *

My Review for All NDUFA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon