Recombinant Human NDUFA12 Protein (1-145 aa), GST-tagged

• Cat.No.: NDUFA12-2151H
• Product Overview: Recombinant Human NDUFA12 Protein (1-145 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-145 aa
• Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 44.1 kDa
• AA Sequence: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: NDUFA12 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [ Homo sapiens (human) ]
• Official Symbol: NDUFA12
• Synonyms: NDUFA12; B17.2; DAP13; CI-B17.2; EC 1.6.5.3; EC 1.6.99.3
• Gene ID: 55967
• mRNA Refseq: NM_001258338
• Protein Refseq: NP_001245267
• MIM: 614530
• UniProt ID: Q9UI09