Recombinant Human NCF4

Cat.No. : NCF4-29348TH
Product Overview : Recombinant full length human NCF4 produced in Saccharomyces cerevisiae; amino acids 1-339 , 39kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Protein Length : 1-339 a.a.
Description : The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Tissue specificity : Expression is restricted to hematopoietic cells.
Form : Liquid
Purity : Immunogen affinity purified
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFV FVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSS ALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSV SPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLL SRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLF PWKLHITQKDNYRVYNTMP
Sequence Similarities : Contains 1 PX (phox homology) domain.Contains 1 SH3 domain.
Full Length : Full L.
Gene Name NCF4 neutrophil cytosolic factor 4, 40kDa [ Homo sapiens ]
Official Symbol NCF4
Synonyms NCF4; neutrophil cytosolic factor 4, 40kDa; neutrophil cytosolic factor 4 (40kD); neutrophil cytosol factor 4; neutrophil NADPH oxidase factor 4; p40phox; SH3PXD4;
Gene ID 4689
mRNA Refseq NM_000631
Protein Refseq NP_000622
MIM 601488
Uniprot ID Q15080
Chromosome Location 22q13.1
Pathway Leishmaniasis, organism-specific biosystem; Leishmaniasis, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Osteoclast differentiation, organism-specific biosystem;
Function phosphatidylinositol binding; protein binding; protein dimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NCF4 Products

Required fields are marked with *

My Review for All NCF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon