Recombinant Human NCF1 protein, GST-tagged

• Cat.No.: NCF1-301532H
• Product Overview: Recombinant Human NCF1 (31-190 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Lys31-Glu190
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: KWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: NCF1 neutrophil cytosolic factor 1 [ Homo sapiens ]
• Official Symbol: NCF1
• Synonyms: NCF1; neutrophil cytosolic factor 1; neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal 1); neutrophil cytosol factor 1; chronic granulomatous disease; autosomal 1; NADPH oxidase organizer 2; NCF1A; NOXO2; p47phox; SH3PXD1A; NCF-1; NCF-47K; p47-phox; nox organizer 2; nox-organizing protein 2; 47 kDa neutrophil oxidase factor; neutrophil NADPH oxidase factor 1; SH3 and PX domain-containing protein 1A; 47 kDa autosomal chronic granulomatous disease protein; neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1); FLJ79451
• Gene ID: 653361
• mRNA Refseq: NM_000265
• Protein Refseq: NP_000256
• MIM: 608512
• UniProt ID: P14598