Recombinant Human NARF, His-tagged

• Cat.No.: NARF-30280TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1-322 of Human NARF Isoform 2 with an N terminal His tag; Predicted MWt 37 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-322 a.a.
• Description: Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 125 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEF HKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFR VLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTD ASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRR YRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTA KSPQQVMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKK LEALQESLPPALHGSRGADCVLTSEISQAWWCTPVITA TREAAARESLEPGRQRLQRDKIAPLDSSLGGGGEIAQI MEQGDLSVRDAAVD

Gene Information

• Gene Name: NARF nuclear prelamin A recognition factor [ Homo sapiens ]
• Official Symbol: NARF
• Synonyms: NARF; nuclear prelamin A recognition factor; DKFZp434G0420; FLJ10067; IOP2; iron only hydrogenase like protein 2
• Gene ID: 26502
• mRNA Refseq: NM_001038618
• Protein Refseq: NP_001033707
• MIM: 605349
• Uniprot ID: Q9UHQ1
• Chromosome Location: 17q25.3
• Function: lamin binding