Recombinant Human NAPG protein, T7-tagged

Source :	E. coli
Species :	Human
Tag :	T7
Form :	1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence :	MASMTGGQQMGRGEFMAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLR EAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQ LYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSP ATPQAKPDGVTATAADEEEDEYSGGLC
Purity :	>90% by SDS-PAGE
Applications :	1. May be used for in vitro human neuronal cell differentiation regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder deseases.5. As antigen for specific antibody production.
Storage :	Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Protein length :	312 a.a.

Gene Name	NAPG N-ethylmaleimide-sensitive factor attachment protein, gamma [ Homo sapiens ]
Official Symbol	NAPG
Synonyms	NAPG; N-ethylmaleimide-sensitive factor attachment protein, gamma; gamma-soluble NSF attachment protein; gamma SNAP; SNAP-gamma; soluble NSF attachment protein; GAMMASNAP;
Gene ID	8774
mRNA Refseq	NM_003826
Protein Refseq	NP_003817
MIM	603216
UniProt ID	Q99747
Chromosome Location	18p11.21
Function	protein binding;