Recombinant Human NAPG protein, T7-tagged

Cat.No. : NAPG-180H
Product Overview : Recombinant human NAPG (312 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 312 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLR EAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQ LYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSP ATPQAKPDGVTATAADEEEDEYSGGLC
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human neuronal cell differentiation regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder deseases.5. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name NAPG N-ethylmaleimide-sensitive factor attachment protein, gamma [ Homo sapiens ]
Official Symbol NAPG
Synonyms NAPG; N-ethylmaleimide-sensitive factor attachment protein, gamma; gamma-soluble NSF attachment protein; gamma SNAP; SNAP-gamma; soluble NSF attachment protein; GAMMASNAP;
Gene ID 8774
mRNA Refseq NM_003826
Protein Refseq NP_003817
MIM 603216
UniProt ID Q99747
Chromosome Location 18p11.21
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NAPG Products

Required fields are marked with *

My Review for All NAPG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon