Recombinant Human NAA50 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NAA50-4182H
• Product Overview: NAA50 MS Standard C13 and N15-labeled recombinant protein (NP_079422) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NAA50 (N-Alpha-Acetyltransferase 50, NatE Catalytic Subunit) is a Protein Coding gene. Diseases associated with NAA50 include Ogden Syndrome and Neuropathy, Hereditary Sensory And Autonomic, Type Iia. Among its related pathways are Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include N-acetyltransferase activity and H4 histone acetyltransferase activity. An important paralog of this gene is NAA30.
• Molecular Mass: 19.4 kDa
• AA Sequence: MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NAA50 N-alpha-acetyltransferase 50, NatE catalytic subunit [ Homo sapiens (human) ]
• Official Symbol: NAA50
• Synonyms: NAA50; N(alpha)-acetyltransferase 50, NatE catalytic subunit; MAK3, Mak3 homolog (S. cerevisiae), N acetyltransferase 13, N acetyltransferase 13 (GCN5 related), NAT13; N-alpha-acetyltransferase 50; FLJ13194; NAT5; San; Mak3 homolog; separation anxiety; N-acetyltransferase 5; natE catalytic subunit; N-acetyltransferase san homolog; N-acetyltransferase 13 (GCN5-related); N-alpha-acetyltransferase 50, NatE catalytic subunit; SAN; MAK3; hSAN; NAT13; hNAT5
• Gene ID: 80218
• mRNA Refseq: NM_025146
• Protein Refseq: NP_079422
• MIM: 610834
• UniProt ID: Q9GZZ1