Recombinant Human MYOZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MYOZ1-3943H
• Product Overview: MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.
• Molecular Mass: 31.7 kDa
• AA Sequence: MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MYOZ1 myozenin 1 [ Homo sapiens (human) ]
• Official Symbol: MYOZ1
• Synonyms: MYOZ1; myozenin 1; MYOZ, myozenin; myozenin-1; calsarcin 2; CS 2; FATZ; calsarcin-2; filamin-, actinin- and telethonin-binding protein; CS-2; MYOZ
• Gene ID: 58529
• mRNA Refseq: NM_021245
• Protein Refseq: NP_067068
• MIM: 605603
• UniProt ID: Q9NP98