Recombinant Human MYOZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MYOZ1-3943H
Product Overview : MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.
Molecular Mass : 31.7 kDa
AA Sequence : MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MYOZ1 myozenin 1 [ Homo sapiens (human) ]
Official Symbol MYOZ1
Synonyms MYOZ1; myozenin 1; MYOZ, myozenin; myozenin-1; calsarcin 2; CS 2; FATZ; calsarcin-2; filamin-, actinin- and telethonin-binding protein; CS-2; MYOZ;
Gene ID 58529
mRNA Refseq NM_021245
Protein Refseq NP_067068
MIM 605603
UniProt ID Q9NP98

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYOZ1 Products

Required fields are marked with *

My Review for All MYOZ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon