Recombinant Human Myosin, Light Chain 1, His-tagged
Cat.No. : | MYL1-4457H |
Product Overview : | Recombinant human MYL1 protein with a His-tag was expressed in E. coli |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. |
Molecular Mass : | The protein has a calculated MW of 23.3 kDa. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from 10mM Tris -HCI, 1mM EDTA PH 7.5, 5% trehalose, 5% manitol |
Gene Name | MYL1 myosin, light chain 1, alkali; skeletal, fast [ Homo sapiens (human) ] |
Official Symbol | MYL1 |
Synonyms | MYL1; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast; myosin light chain 1/3, skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; A1 catalytic; A2 catalytic; myosin light chain A1/A2; myosin light chain alkali 1/2; myosin, light polypeptide 1, alkali; skeletal, fast; MLC1F; MLC3F; |
Gene ID | 4632 |
mRNA Refseq | NM_079420 |
Protein Refseq | NP_524144 |
MIM | 160780 |
UniProt ID | P05976 |
◆ Recombinant Proteins | ||
MYL1-29363TH | Recombinant Human MYL1 | +Inquiry |
Myl1-4248M | Recombinant Mouse Myl1 Protein, Myc/DDK-tagged | +Inquiry |
MYL1-5806H | Recombinant Human MYL1 Protein, GST-tagged | +Inquiry |
MYL1-6758HF | Recombinant Full Length Human MYL1 Protein, GST-tagged | +Inquiry |
Myl1-1508R | Recombinant Rat Myl1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL1-4031HCL | Recombinant Human MYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL1 Products
Required fields are marked with *
My Review for All MYL1 Products
Required fields are marked with *
0
Inquiry Basket