Recombinant Human MYOM3 Protein, GST-tagged

• Cat.No.: MYOM3-5855H
• Product Overview: Human MYOM3 partial ORF ( NP_689585, 854 a.a. - 955 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MYOM3 (Myomesin 3) is a Protein Coding gene. GO annotations related to this gene include protein homodimerization activity. An important paralog of this gene is MYOM2.
• Molecular Mass: 36.96 kDa
• AA Sequence: GPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYOM3 myomesin 3 [ Homo sapiens (human) ]
• Official Symbol: MYOM3
• Synonyms: MYOM3; myomesin 3; myomesin-3; myomesin family, member 3
• Gene ID: 127294
• mRNA Refseq: NM_152372
• Protein Refseq: NP_689585
• MIM: 616832
• UniProt ID: Q5VTT5